SCOPe 2.06: Domain d1j92c_: 1j92 C:

Lineage for d1j92c_ (1j92 C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein automated matches [190299] (7 species)
   not a true protein

7. Species Mus musculus [311150] (7 PDB entries)

8. Domain d1j92c_: 1j92 C: [302558]
   Other proteins in same PDB: d1j92b1, d1j92b2, d1j92d_
   automated match to d1yroa_
   complexed with ca, nag

Details for d1j92c_

PDB Entry: 1j92, 2 Å

PDB Description: crystal structure of lactose synthase, complex with n-acetylglucosamine

PDB Compounds: (C:) alpha-lactalbumin

SCOPe Domain Sequences for d1j92c_:

Sequence; same for both SEQRES and ATOM records:

>d1j92c_ d.2.1.2 (C:) automated matches {Mus musculus}
teltkckvshaikdmdgyqgisllewtcvlfhtsgydsqavvndngsteyglfqiserfw
ckssefpesenicgiscdkllddeldddivcakkivaikgidywkaykpmcsekleqwrc
ekp

Timeline for d1j92c_:

• d1j92c_ is new in SCOPe 2.06-stable
  
• d1j92c_ appears in SCOPe 2.07
  
• d1j92c_ appears in the current release, SCOPe 2.08