Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein ADP-ribosylation factor [52614] (16 species) |
Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (14 PDB entries) Uniprot P32889 |
Domain d1j2ib1: 1j2i B:18-181 [302528] Other proteins in same PDB: d1j2ia2, d1j2ib2 automated match to d1o3ya_ complexed with gtp, mg |
PDB Entry: 1j2i (more details), 1.5 Å
SCOPe Domain Sequences for d1j2ib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j2ib1 c.37.1.8 (B:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkirpl wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa eitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk
Timeline for d1j2ib1: