SCOPe 2.06: Domain d1j2ib1: 1j2i B:18-181

Lineage for d1j2ib1 (1j2i B:18-181)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (16 species)

7. Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (14 PDB entries)
   Uniprot P32889

8. Domain d1j2ib1: 1j2i B:18-181 [302528]
   Other proteins in same PDB: d1j2ia2, d1j2ib2
   automated match to d1o3ya_
   complexed with gtp, mg

Details for d1j2ib1

PDB Entry: 1j2i, 1.5 Å

PDB Description: Crystal structure of mouse ARF1 (delta17-Q71L), GTP form

PDB Compounds: (B:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d1j2ib1:

Sequence; same for both SEQRES and ATOM records:

>d1j2ib1 c.37.1.8 (B:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}
mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkirpl
wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
eitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk

Timeline for d1j2ib1:

• d1j2ib1 is new in SCOPe 2.06-stable
  
• d1j2ib1 appears in SCOPe 2.07
  
• d1j2ib1 appears in the current release, SCOPe 2.08