SCOP 1.75: Domain d1hwxc1: 1hwx C:209-501

Lineage for d1hwxc1 (1hwx C:209-501)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Glutamate dehydrogenase [51884] (8 species)

7. Species Cow (Bos taurus) [TaxId:9913] [51889] (5 PDB entries)

8. Domain d1hwxc1: 1hwx C:209-501 [30252]
   Other proteins in same PDB: d1hwxa2, d1hwxb2, d1hwxc2, d1hwxd2, d1hwxe2, d1hwxf2

Details for d1hwxc1

PDB Entry: 1hwx, 2.5 Å

PDB Description: crystal structure of bovine liver glutamate dehydrogenase complexed with gtp, nadh, and l-glutamic acid

PDB Compounds: (C:) glutamate dehydrogenase

SCOP Domain Sequences for d1hwxc1:

Sequence; same for both SEQRES and ATOM records:

>d1hwxc1 c.2.1.7 (C:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
hgrisatgrgvfhgienfienasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfga
kcvavgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpqadkiflernimvipdlylnaggvtvsyfqilkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft

Timeline for d1hwxc1:

• d1hwxc1 first appeared (with stable ids) in SCOP 1.55
  
• d1hwxc1 appears in SCOP 1.73
  
• d1hwxc1 does not appear in SCOPe 2.01