Lineage for d1hwxa1 (1hwx A:209-501)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175982Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins)
  6. 175983Protein Glutamate dehydrogenase [51884] (7 species)
  7. 176009Species Cow (Bos taurus) [TaxId:9913] [51889] (3 PDB entries)
  8. 176010Domain d1hwxa1: 1hwx A:209-501 [30250]
    Other proteins in same PDB: d1hwxa2, d1hwxb2, d1hwxc2, d1hwxd2, d1hwxe2, d1hwxf2

Details for d1hwxa1

PDB Entry: 1hwx (more details), 2.5 Å

PDB Description: crystal structure of bovine liver glutamate dehydrogenase complexed with gtp, nadh, and l-glutamic acid

SCOP Domain Sequences for d1hwxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus)}
hgrisatgrgvfhgienfienasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfga
kcvavgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpqadkiflernimvipdlylnaggvtvsyfqilkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft

SCOP Domain Coordinates for d1hwxa1:

Click to download the PDB-style file with coordinates for d1hwxa1.
(The format of our PDB-style files is described here.)

Timeline for d1hwxa1: