SCOPe 2.06: Domain d1hwxa3: 1hwx A:1-208

Lineage for d1hwxa3 (1hwx A:1-208)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
   dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet

6. Protein Glutamate dehydrogenase [53225] (8 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53230] (8 PDB entries)

8. Domain d1hwxa3: 1hwx A:1-208 [302490]
   Other proteins in same PDB: d1hwxa4, d1hwxb4, d1hwxc4, d1hwxd4, d1hwxe4, d1hwxf4
   automated match to d1hwza2
   complexed with glu, gtp, nai

Details for d1hwxa3

PDB Entry: 1hwx, 2.5 Å

PDB Description: crystal structure of bovine liver glutamate dehydrogenase complexed with gtp, nadh, and l-glutamic acid

PDB Compounds: (A:) glutamate dehydrogenase

SCOPe Domain Sequences for d1hwxa3:

Sequence; same for both SEQRES and ATOM records:

>d1hwxa3 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
dtyastighydinahacvtgkpisqggi

Timeline for d1hwxa3:

• d1hwxa3 is new in SCOPe 2.06-stable
  
• d1hwxa3 appears in SCOPe 2.07
  
• d1hwxa3 appears in the current release, SCOPe 2.08