Lineage for d1hlra6 (1hlr A:81-193)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000915Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2000916Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2001023Family a.56.1.0: automated matches [227241] (1 protein)
    not a true family
  6. 2001024Protein automated matches [227007] (5 species)
    not a true protein
  7. 2001025Species Desulfovibrio gigas [TaxId:879] [311145] (1 PDB entry)
  8. 2001026Domain d1hlra6: 1hlr A:81-193 [302486]
    Other proteins in same PDB: d1hlra5, d1hlra7, d1hlra8
    automated match to d1dgja1
    complexed with cl, fes, ipa, mg, pcd

Details for d1hlra6

PDB Entry: 1hlr (more details), 1.28 Å

PDB Description: structure refinement of the aldehyde oxidoreductase from desulfovibrio gigas at 1.28 a
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d1hlra6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlra6 a.56.1.0 (A:81-193) automated matches {Desulfovibrio gigas [TaxId: 879]}
qpenlhplqkawvlhggaqcgfcspgfivsakglldtnadpsredvrdwfqkhrnacrct
gykplvdavmdaaavingkkpetdlefkmpadgriwgskyprptavakvtgtl

SCOPe Domain Coordinates for d1hlra6:

Click to download the PDB-style file with coordinates for d1hlra6.
(The format of our PDB-style files is described here.)

Timeline for d1hlra6: