Lineage for d1h6za6 (1h6z A:538-903)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2446508Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2446911Family c.1.12.0: automated matches [191427] (1 protein)
    not a true family
  6. 2446912Protein automated matches [190614] (15 species)
    not a true protein
  7. 2446994Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [311143] (1 PDB entry)
  8. 2446995Domain d1h6za6: 1h6z A:538-903 [302458]
    Other proteins in same PDB: d1h6za4, d1h6za5
    automated match to d2x0sa1

Details for d1h6za6

PDB Entry: 1h6z (more details), 3 Å

PDB Description: 3.0 a resolution crystal structure of glycosomal pyruvate phosphate dikinase from trypanosoma brucei
PDB Compounds: (A:) pyruvate phosphate dikinase

SCOPe Domain Sequences for d1h6za6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6za6 c.1.12.0 (A:538-903) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
rspdlkgsfqtilqwcqemkrlgvrtnadtpadaakarsfgaegvglcrtehmffegsri
nfiremiladsasgrkaaldkllpiqradfvgilramrglpvtirlldpplhefvphdaa
aqfelaqklgmpaekvrnrvnalhelnpmlghrgcrlgitypeiynmqvraiieaaiavs
eegssvipeimvplvgkkeelslireevvktaeavitksgkrvhytvgtmievpraavta
dsiaqkadffsfgtndltqmgcgfsrddagpflrhygnlgiyaqdpfqsidqegigelvr
iavtkgrrvkpmlkmgicgehggdpatigfchkvgldyvscspfrvpvaivaaahasikd
rraamk

SCOPe Domain Coordinates for d1h6za6:

Click to download the PDB-style file with coordinates for d1h6za6.
(The format of our PDB-style files is described here.)

Timeline for d1h6za6: