Lineage for d1h6za4 (1h6z A:1-405)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541644Family d.142.1.5: Pyruvate phosphate dikinase, N-terminal domain [56085] (2 proteins)
    automatically mapped to Pfam PF01326
  6. 2541659Protein automated matches [310839] (1 species)
    not a true protein
  7. 2541660Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [311141] (1 PDB entry)
  8. 2541661Domain d1h6za4: 1h6z A:1-405 [302456]
    Other proteins in same PDB: d1h6za5, d1h6za6
    automated match to d2x0sa3

Details for d1h6za4

PDB Entry: 1h6z (more details), 3 Å

PDB Description: 3.0 a resolution crystal structure of glycosomal pyruvate phosphate dikinase from trypanosoma brucei
PDB Compounds: (A:) pyruvate phosphate dikinase

SCOPe Domain Sequences for d1h6za4:

Sequence, based on SEQRES records: (download)

>d1h6za4 d.142.1.5 (A:1-405) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
vakkwvyyfgggnadgnknmkellggkganlaemvnlgipvppgftitteacktyqetet
ipqevadqvrenvsrvekemgakfgdpanpllfsvrsgaaasmpgmmdtvlnlglnkvtv
dawvrraprlerfvydsyrrfitmyadivmqvgredfeealsrmkerrgtkfdtdltasd
lkelcdgylelfelktgcsfpqdpvmqlfaaikavfrswgnpratiyrrmnnitgllgta
vnvqamvfgnindrsatgvafsrspstgenfffgeylvnaqgedvvagirtpqqinhsls
lrwakahgvgeeerrkrypsmeeampenyrllcdvrkrlenhyrdmqdleftvqdgrlwl
lqcrngkrtihaavriaidmvneglisreeavlridpyqvdhlmh

Sequence, based on observed residues (ATOM records): (download)

>d1h6za4 d.142.1.5 (A:1-405) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
vakkwvyyfgggnadgnknmkellggkganlaemvnlgipvppgftitteacktyqetet
ipqevadqvrenvsrvekemgakfgdpanpllfsvrsgaaasdtvlnlglnkvtvdawvr
raprlerfvydsyrrfitmyadivmqvgredfeealsrmkerrgtkfdtdltasdlkelc
dgylelfelktgcsfpqdpvmqlfaaikavfrswgnpratiyrrmnnitgllgtavnvqa
mvfgnindrsatgvafsrspstgenfffgeylvnaqgedvvagirtpqqinhslslrwak
ahgvgeeerrkrypsmeeampenyrllcdvrkrlenhyrdmqdleftvqdgrlwllqcrn
gkrtihaavriaidmvneglisreeavlridpyqvdhlmh

SCOPe Domain Coordinates for d1h6za4:

Click to download the PDB-style file with coordinates for d1h6za4.
(The format of our PDB-style files is described here.)

Timeline for d1h6za4: