![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.4: SNARE-like [64356] (5 families) ![]() beta(2)-alpha-beta(3)-alpha(2) |
![]() | Family d.110.4.2: Clathrin coat assembly domain [75521] (2 proteins) automatically mapped to Pfam PF01217 |
![]() | Protein Sigma2 adaptin (clathrin coat assembly protein AP17) [75524] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [75525] (5 PDB entries) |
![]() | Domain d1gw5s_: 1gw5 S: [302452] Other proteins in same PDB: d1gw5b_ automated match to d2vgls_ complexed with ihp |
PDB Entry: 1gw5 (more details), 2.59 Å
SCOPe Domain Sequences for d1gw5s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gw5s_ d.110.4.2 (S:) Sigma2 adaptin (clathrin coat assembly protein AP17) {Mouse (Mus musculus) [TaxId: 10090]} mirfiliqnragktrlakwymqfdddekqklieevhavvtvrdakhtnfvefrnfkiiyr ryaglyfcicvdvndnnlayleaihnfvevlneyfhnvceldlvfnfykvytvvdemfla geiretsqtkvlkqllmlqsle
Timeline for d1gw5s_: