Lineage for d1b3ba1 (1b3b A:179-412)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20664Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins)
  6. 20665Protein Glutamate dehydrogenase [51884] (5 species)
  7. 20703Species Thermotoga maritima [TaxId:243274] [51888] (3 PDB entries)
  8. 20716Domain d1b3ba1: 1b3b A:179-412 [30244]
    Other proteins in same PDB: d1b3ba2, d1b3bb2, d1b3bc2, d1b3bd2, d1b3be2, d1b3bf2

Details for d1b3ba1

PDB Entry: 1b3b (more details), 3.1 Å

PDB Description: thermotoga maritima glutamate dehydrogenase mutant n97d, g376k

SCOP Domain Sequences for d1b3ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3ba1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima}
ggskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvva
vsdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegai
hagnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqs
ffwdldqvrnalekmmkkafndvmkvkekynvdmrtaayilaidrvayatkkrg

SCOP Domain Coordinates for d1b3ba1:

Click to download the PDB-style file with coordinates for d1b3ba1.
(The format of our PDB-style files is described here.)

Timeline for d1b3ba1: