Lineage for d2tmgf1 (2tmg F:179-411)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66936Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins)
  6. 66937Protein Glutamate dehydrogenase [51884] (6 species)
  7. 66982Species Thermotoga maritima [TaxId:243274] [51888] (3 PDB entries)
  8. 66994Domain d2tmgf1: 2tmg F:179-411 [30243]
    Other proteins in same PDB: d2tmga2, d2tmgb2, d2tmgc2, d2tmgd2, d2tmge2, d2tmgf2

Details for d2tmgf1

PDB Entry: 2tmg (more details), 2.9 Å

PDB Description: thermotoga maritima glutamate dehydrogenase mutant s128r, t158e, n117r, s160e

SCOP Domain Sequences for d2tmgf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tmgf1 c.2.1.7 (F:179-411) Glutamate dehydrogenase {Thermotoga maritima}
ggskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvva
vsdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegai
hagnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqs
ffwdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkr

SCOP Domain Coordinates for d2tmgf1:

Click to download the PDB-style file with coordinates for d2tmgf1.
(The format of our PDB-style files is described here.)

Timeline for d2tmgf1: