SCOPe 2.06: Domain d1gm3h1: 1gm3 H:1-113

Lineage for d1gm3h1 (1gm3 H:1-113)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (59 PDB entries)
   Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10

8. Domain d1gm3h1: 1gm3 H:1-113 [302427]
   Other proteins in same PDB: d1gm3h2, d1gm3l1, d1gm3l2
   automated match to d1h3ph1

Details for d1gm3h1

PDB Entry: 1gm3, 2.6 Å

PDB Description: structural characterisation of a monoclonal antibody specific for the pres1 region of the hepatitis b virus

PDB Compounds: (H:) immunoglobulin heavy chain

SCOPe Domain Sequences for d1gm3h1:

Sequence; same for both SEQRES and ATOM records:

>d1gm3h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evqlvesggglvkpggslklscaasgftfssyamswvrqspekrlewvaevssdgsyayy
pdtltgrftisrdnakntlylemtslrsedtamyycasfnwdvaywgqgtlvtvsa

Timeline for d1gm3h1:

• d1gm3h1 is new in SCOPe 2.06-stable
  
• d1gm3h1 appears in SCOPe 2.07
  
• d1gm3h1 appears in the current release, SCOPe 2.08