SCOP 1.55: Domain d2tmgd1: 2tmg D:179-411

Lineage for d2tmgd1 (2tmg D:179-411)

Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families)
Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins)
Protein Glutamate dehydrogenase [51884] (5 species)
Species Thermotoga maritima [TaxId:243274] [51888] (3 PDB entries)
Domain d2tmgd1: 2tmg D:179-411 [30241]
Other proteins in same PDB: d2tmga2, d2tmgb2, d2tmgc2, d2tmgd2, d2tmge2, d2tmgf2

Details for d2tmgd1

PDB Entry: 2tmg (more details), 2.9 Å

PDB Description: thermotoga maritima glutamate dehydrogenase mutant s128r, t158e, n117r, s160e

SCOP Domain Sequences for d2tmgd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tmgd1 c.2.1.7 (D:179-411) Glutamate dehydrogenase {Thermotoga maritima}
ggskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvva
vsdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegai
hagnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqs
ffwdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkr

SCOP Domain Coordinates for d2tmgd1:

Click to download the PDB-style file with coordinates for d2tmgd1.
(The format of our PDB-style files is described here.)

Timeline for d2tmgd1: