Lineage for d1b26f1 (1b26 F:179-412)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20664Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins)
  6. 20665Protein Glutamate dehydrogenase [51884] (5 species)
  7. 20703Species Thermotoga maritima [TaxId:243274] [51888] (3 PDB entries)
  8. 20709Domain d1b26f1: 1b26 F:179-412 [30237]
    Other proteins in same PDB: d1b26a2, d1b26b2, d1b26c2, d1b26d2, d1b26e2, d1b26f2

Details for d1b26f1

PDB Entry: 1b26 (more details), 3 Å

PDB Description: glutamate dehydrogenase

SCOP Domain Sequences for d1b26f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b26f1 c.2.1.7 (F:179-412) Glutamate dehydrogenase {Thermotoga maritima}
ggskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvva
vsdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegai
hagnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqs
ffwdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrg

SCOP Domain Coordinates for d1b26f1:

Click to download the PDB-style file with coordinates for d1b26f1.
(The format of our PDB-style files is described here.)

Timeline for d1b26f1: