SCOPe 2.08: Domain d1e13b1: 1e13 B:104-171

Lineage for d1e13b1 (1e13 B:104-171)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein automated matches [191035] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255382] (5 PDB entries)

8. Domain d1e13b1: 1e13 B:104-171 [302360]
   Other proteins in same PDB: d1e13a2, d1e13b2
   automated match to d1s4za_

Details for d1e13b1

PDB Entry: 1e13

PDB Description: mouse hp1 (m31) c terminal (shadow chromo) domain

PDB Compounds: (B:) modifier 1 protein

SCOPe Domain Sequences for d1e13b1:

Sequence; same for both SEQRES and ATOM records:

>d1e13b1 b.34.13.2 (B:104-171) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
keesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisf
yeerltwh

Timeline for d1e13b1:

• d1e13b1 first appeared in SCOPe 2.06
  
• d1e13b1 appears in SCOPe 2.07