Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) |
Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (10 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
Protein Glutamate dehydrogenase [51884] (7 species) |
Species Thermotoga maritima [TaxId:243274] [51888] (3 PDB entries) |
Domain d1b26d1: 1b26 D:179-412 [30235] Other proteins in same PDB: d1b26a2, d1b26b2, d1b26c2, d1b26d2, d1b26e2, d1b26f2 |
PDB Entry: 1b26 (more details), 3 Å
SCOP Domain Sequences for d1b26d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b26d1 c.2.1.7 (D:179-412) Glutamate dehydrogenase {Thermotoga maritima} ggskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvva vsdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegai hagnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqs ffwdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrg
Timeline for d1b26d1: