Lineage for d1b26d1 (1b26 D:179-412)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) 
Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins) 
Protein Glutamate dehydrogenase [51884] (6 species) 
Species Thermotoga maritima [TaxId:243274] [51888] (3 PDB entries) 
Domain d1b26d1: 1b26 D:179-412 [30235]
Other proteins in same PDB: d1b26a2, d1b26b2, d1b26c2, d1b26d2, d1b26e2, d1b26f2
Details for d1b26d1
PDB Entry: 1b26 (more details), 3 Å
PDB Description: glutamate dehydrogenase
SCOP Domain Sequences for d1b26d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b26d1 c.2.1.7 (D:179-412) Glutamate dehydrogenase {Thermotoga maritima}
ggskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvva
vsdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegai
hagnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqs
ffwdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrg
SCOP Domain Coordinates for d1b26d1:
Click to download the PDB-style file with coordinates for d1b26d1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b26d1:
View in 3D
