Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Escherichia coli [311130] (1 PDB entry) |
Domain d1dooa_: 1doo A: [302345] Other proteins in same PDB: d1dooe_, d1doof_ automated match to d1g4aa_ complexed with anp |
PDB Entry: 1doo (more details), 2.81 Å
SCOPe Domain Sequences for d1dooa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dooa_ d.153.1.4 (A:) automated matches {Escherichia coli} ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy
Timeline for d1dooa_: