Lineage for d1dooa_ (1doo A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2995053Species Escherichia coli [311130] (1 PDB entry)
  8. 2995054Domain d1dooa_: 1doo A: [302345]
    Other proteins in same PDB: d1dooe_, d1doof_
    automated match to d1g4aa_
    complexed with anp

Details for d1dooa_

PDB Entry: 1doo (more details), 2.81 Å

PDB Description: heat shock locus v (hslv)-heat shock locus u (hslu) from e. coli
PDB Compounds: (A:) protein (heat shock locus v)

SCOPe Domain Sequences for d1dooa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dooa_ d.153.1.4 (A:) automated matches {Escherichia coli}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy

SCOPe Domain Coordinates for d1dooa_:

Click to download the PDB-style file with coordinates for d1dooa_.
(The format of our PDB-style files is described here.)

Timeline for d1dooa_: