SCOP 1.69: Domain d1b26a1: 1b26 A:179-412

Lineage for d1b26a1 (1b26 A:179-412)

Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

Protein Glutamate dehydrogenase [51884] (7 species)
Species Thermotoga maritima [TaxId:243274] [51888] (3 PDB entries)
Domain d1b26a1: 1b26 A:179-412 [30232]
Other proteins in same PDB: d1b26a2, d1b26b2, d1b26c2, d1b26d2, d1b26e2, d1b26f2

Details for d1b26a1

PDB Entry: 1b26 (more details), 3 Å

PDB Description: glutamate dehydrogenase

SCOP Domain Sequences for d1b26a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima}
ggskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvva
vsdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegai
hagnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqs
ffwdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrg

SCOP Domain Coordinates for d1b26a1:

Click to download the PDB-style file with coordinates for d1b26a1.
(The format of our PDB-style files is described here.)

Timeline for d1b26a1: