SCOPe 2.08: Domain d1db8a3: 1db8 A:8-137

Lineage for d1db8a3 (1db8 A:8-137)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein automated matches [190352] (10 species)
   not a true protein

7. Species Escherichia coli [TaxId:469008] [255647] (4 PDB entries)

8. Domain d1db8a3: 1db8 A:8-137 [302314]
   Other proteins in same PDB: d1db8a4
   automated match to d4i02b1
   protein/DNA complex; complexed with cmp

Details for d1db8a3

PDB Entry: 1db8, 3 Å

PDB Description: protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes

PDB Compounds: (A:) catabolite gene activator protein

SCOPe Domain Sequences for d1db8a3:

Sequence; same for both SEQRES and ATOM records:

>d1db8a3 b.82.3.2 (A:8-137) automated matches {Escherichia coli [TaxId: 469008]}
dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
sekvgnlafl

Timeline for d1db8a3:

• d1db8a3 first appeared in SCOPe 2.06
  
• d1db8a3 appears in SCOPe 2.07