SCOPe 2.06: Domain d1db7a4: 1db7 A:138-207

Lineage for d1db7a4 (1db7 A:138-207)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (68 species)
   not a true protein

7. Species Escherichia coli [311127] (3 PDB entries)

8. Domain d1db7a4: 1db7 A:138-207 [302313]
   Other proteins in same PDB: d1db7a3
   automated match to d4i02a2
   protein/DNA complex; complexed with cmp

Details for d1db7a4

PDB Entry: 1db7, 3 Å

PDB Description: protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes

PDB Compounds: (A:) catabolite gene activator protein

SCOPe Domain Sequences for d1db7a4:

Sequence; same for both SEQRES and ATOM records:

>d1db7a4 a.4.5.0 (A:138-207) automated matches {Escherichia coli}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

Timeline for d1db7a4:

• d1db7a4 is new in SCOPe 2.06-stable
  
• d1db7a4 appears in SCOPe 2.07
  
• d1db7a4 appears in the current release, SCOPe 2.08