Lineage for d1ct7a1 (1ct7 A:21-69)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639662Fold g.29: Type X cellulose binding domain, CBDX [57614] (1 superfamily)
    disulfide-rich, alpha+beta
  4. 2639663Superfamily g.29.1: Type X cellulose binding domain, CBDX [57615] (1 family) (S)
  5. 2639664Family g.29.1.1: Type X cellulose binding domain, CBDX [57616] (1 protein)
  6. 2639665Protein Endo-1;4-beta-xylanase A CBDX [57617] (2 species)
  7. 2639666Species Pseudomonas fluorescens [311124] (1 PDB entry)
  8. 2639667Domain d1ct7a1: 1ct7 A:21-69 [302296]
    Other proteins in same PDB: d1ct7a2
    automated match to d1qlda_

Details for d1ct7a1

PDB Entry: 1ct7 (more details)

PDB Description: solution structure of type x cbd
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d1ct7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ct7a1 g.29.1.1 (A:21-69) Endo-1;4-beta-xylanase A CBDX {Pseudomonas fluorescens}
gnqqcnwygtlyplcvtttngwgwedqrsciarstcaaqpapfgivgsg

SCOPe Domain Coordinates for d1ct7a1:

Click to download the PDB-style file with coordinates for d1ct7a1.
(The format of our PDB-style files is described here.)

Timeline for d1ct7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ct7a2