Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Cupriavidus necator [TaxId:106590] [311122] (1 PDB entry) |
Domain d1chrb3: 1chr B:1-126 [302286] Other proteins in same PDB: d1chra4, d1chrb4 automated match to d2chra2 complexed with cl, mn |
PDB Entry: 1chr (more details), 3 Å
SCOPe Domain Sequences for d1chrb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1chrb3 d.54.1.0 (B:1-126) automated matches {Cupriavidus necator [TaxId: 106590]} mkidaieavivdvptkrpiqmsittvhqqsyvivrvyseglvgvgeggsvggpvwsaeca etikiiverylaphllgtdafnvsgalqtmaravtgnasakaavemalldlkaralgvsi aellgg
Timeline for d1chrb3: