SCOPe 2.08: Domain d1cf6b3: 1cf6 B:10-91

Lineage for d1cf6b3 (1cf6 B:10-91)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.0: automated matches [254214] (1 protein)
   not a true family

6. Protein automated matches [254482] (3 species)
   not a true protein

7. Species Rattus norvegicus [311121] (1 PDB entry)

8. Domain d1cf6b3: 1cf6 B:10-91 [302275]
   Other proteins in same PDB: d1cf6a4, d1cf6a5, d1cf6b4, d1cf6b5
   automated match to d1tv9a1
   protein/DNA complex; complexed with cr, ucp

Details for d1cf6b3

PDB Entry: 1cf6, 3.1 Å

PDB Description: structure of dna polymerase beta/dna template-primer/utp phosphonate intermediate complex--potential insight into the molecular basis of fidelity

PDB Compounds: (B:) protein (DNA polymerase beta)

SCOPe Domain Sequences for d1cf6b3:

Sequence; same for both SEQRES and ATOM records:

>d1cf6b3 a.60.6.0 (B:10-91) automated matches {Rattus norvegicus}
tlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
aekideflatgklrklekirqd

Timeline for d1cf6b3:

• d1cf6b3 first appeared in SCOPe 2.06
  
• d1cf6b3 appears in SCOPe 2.07