Lineage for d1cf6a3 (1cf6 A:10-91)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715906Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2716133Family a.60.6.0: automated matches [254214] (1 protein)
    not a true family
  6. 2716134Protein automated matches [254482] (3 species)
    not a true protein
  7. 2716186Species Rattus norvegicus [311121] (1 PDB entry)
  8. 2716187Domain d1cf6a3: 1cf6 A:10-91 [302272]
    Other proteins in same PDB: d1cf6a4, d1cf6a5, d1cf6b4, d1cf6b5
    automated match to d1tv9a1
    protein/DNA complex; complexed with cr, ucp

Details for d1cf6a3

PDB Entry: 1cf6 (more details), 3.1 Å

PDB Description: structure of dna polymerase beta/dna template-primer/utp phosphonate intermediate complex--potential insight into the molecular basis of fidelity
PDB Compounds: (A:) protein (DNA polymerase beta)

SCOPe Domain Sequences for d1cf6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf6a3 a.60.6.0 (A:10-91) automated matches {Rattus norvegicus}
tlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
aekideflatgklrklekirqd

SCOPe Domain Coordinates for d1cf6a3:

Click to download the PDB-style file with coordinates for d1cf6a3.
(The format of our PDB-style files is described here.)

Timeline for d1cf6a3: