SCOPe 2.06: Domain d1bvub1: 1bvu B:181-418

Lineage for d1bvub1 (1bvu B:181-418)

Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

Protein Glutamate dehydrogenase [51884] (8 species)
Species Thermococcus litoralis [TaxId:2265] [51887] (1 PDB entry)
Domain d1bvub1: 1bvu B:181-418 [30227]
Other proteins in same PDB: d1bvua2, d1bvub2, d1bvuc2, d1bvud2, d1bvue2, d1bvuf2

Details for d1bvub1

PDB Entry: 1bvu (more details), 2.5 Å

PDB Description: glutamate dehydrogenase from thermococcus litoralis

PDB Compounds: (B:) protein (glutamate dehydrogenase)

SCOPe Domain Sequences for d1bvub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvub1 c.2.1.7 (B:181-418) Glutamate dehydrogenase {Thermococcus litoralis [TaxId: 2265]}
ggivarmdatargasytvreaakalgmdlkgktiaiqgygnagyymakimseeygmkvva
vsdtkggiynpdglnadevlawkkktgsvkdfpgatnitneellelevdvlapsaieevi
tkknadnikakivaelangpttpeadeilyekgiliipdflcnaggvtvsyfewvqnitg
dywtveetrakldkkmtkafwdvynthkekninmrdaayvvavsrvyqamkdrgwikk

SCOPe Domain Coordinates for d1bvub1:

Click to download the PDB-style file with coordinates for d1bvub1.
(The format of our PDB-style files is described here.)

Timeline for d1bvub1: