Lineage for d1bvub1 (1bvu B:181-418)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175982Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins)
  6. 175983Protein Glutamate dehydrogenase [51884] (7 species)
  7. 175988Species Archaeon Thermococcus litoralis [TaxId:2265] [51887] (1 PDB entry)
  8. 175990Domain d1bvub1: 1bvu B:181-418 [30227]
    Other proteins in same PDB: d1bvua2, d1bvub2, d1bvuc2, d1bvud2, d1bvue2, d1bvuf2

Details for d1bvub1

PDB Entry: 1bvu (more details), 2.5 Å

PDB Description: glutamate dehydrogenase from thermococcus litoralis

SCOP Domain Sequences for d1bvub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvub1 c.2.1.7 (B:181-418) Glutamate dehydrogenase {Archaeon Thermococcus litoralis}
ggivarmdatargasytvreaakalgmdlkgktiaiqgygnagyymakimseeygmkvva
vsdtkggiynpdglnadevlawkkktgsvkdfpgatnitneellelevdvlapsaieevi
tkknadnikakivaelangpttpeadeilyekgiliipdflcnaggvtvsyfewvqnitg
dywtveetrakldkkmtkafwdvynthkekninmrdaayvvavsrvyqamkdrgwikk

SCOP Domain Coordinates for d1bvub1:

Click to download the PDB-style file with coordinates for d1bvub1.
(The format of our PDB-style files is described here.)

Timeline for d1bvub1: