Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins) automatically mapped to Pfam PF00135 |
Protein automated matches [190065] (7 species) not a true protein |
Species Bacillus subtilis [311120] (1 PDB entry) |
Domain d1c00a_: 1c00 A: [302264] automated match to d1c7ja_ complexed with ca |
PDB Entry: 1c00 (more details), 2 Å
SCOPe Domain Sequences for d1c00a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c00a_ c.69.1.1 (A:) automated matches {Bacillus subtilis} thqivttqygkvkgttengvhkwkgipyakppvgqwrfkapeppevwedvldatvygpvc pqpsdllslsykelprqsedclyvnvfapdtpsqnlpvmvwihggafylgagseplydgs klaaqgevivvtlnyrlgpfgflhlssfdeaysdnlglldqaaalkwvrenisafggdpd nvtvfgesaggmsiaallampaakglfqkaimesgasrtmtkeqaastaaaflqvlgine sqldrlhtvaaedllkaadqlriaekenifqlffqpaldpktlpeepeksiaegaasgip lligttrdegyffftpdsdvysqetldaaleyllgkplaekvadlyprslesqihmvtdl lfwrpavafasaqshyapvwmyrfdwhpekppynkafhtlelpfvfgnldelermakagi tdevkqlshtiqsawttfaktgnpsteavnwpayheesretvildseitiendpesekrq klf
Timeline for d1c00a_: