Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) |
Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
Protein automated matches [190066] (7 species) not a true protein |
Species Spinacia oleracea [311119] (1 PDB entry) |
Domain d1burv_: 1bur V: [302258] Other proteins in same PDB: d1bura3, d1bura4, d1burb3, d1burb4, d1burc3, d1burc4, d1burd3, d1burd4 automated match to d8ruci_ complexed with cap, mg |
PDB Entry: 1bur (more details), 1.8 Å
SCOPe Domain Sequences for d1burv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1burv_ d.73.1.1 (V:) automated matches {Spinacia oleracea} mqvwpilgmkkyetlsylppltteqllaevnyllvnnwipclefevkdgfvyrehhkspg yydgrywtmwklpmfgctdpaqvlneleeckkaypdafiriigfdnkrqvqcisfiaykp agy
Timeline for d1burv_: