Lineage for d1burs_ (1bur S:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2524228Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2524229Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2524230Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2524388Protein automated matches [190066] (7 species)
    not a true protein
  7. 2524470Species Spinacia oleracea [311119] (1 PDB entry)
  8. 2524471Domain d1burs_: 1bur S: [302255]
    Other proteins in same PDB: d1bura3, d1bura4, d1burb3, d1burb4, d1burc3, d1burc4, d1burd3, d1burd4
    automated match to d8ruci_
    complexed with cap, mg

Details for d1burs_

PDB Entry: 1bur (more details), 1.8 Å

PDB Description: ribulose 1,5-bisphosphate carboxylase/oxygenase complexed with carbon dioxide, mg2+ and 2-carboxyarabinitol-1,5-bisphosphate
PDB Compounds: (S:) ribulose 1,5-bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1burs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1burs_ d.73.1.1 (S:) automated matches {Spinacia oleracea}
mqvwpilgmkkyetlsylppltteqllaevnyllvnnwipclefevkdgfvyrehlkspg
yydgrywtmwklpmfgctdpaqvlneleeckkaypdafiriigfdnkrqvqcisfiaykp
agy

SCOPe Domain Coordinates for d1burs_:

Click to download the PDB-style file with coordinates for d1burs_.
(The format of our PDB-style files is described here.)

Timeline for d1burs_: