Lineage for d1gtmc1 (1gtm C:181-419)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175982Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins)
  6. 175983Protein Glutamate dehydrogenase [51884] (7 species)
  7. 175984Species Archaeon Pyrococcus furiosus [TaxId:2261] [51886] (1 PDB entry)
  8. 175987Domain d1gtmc1: 1gtm C:181-419 [30225]
    Other proteins in same PDB: d1gtma2, d1gtmb2, d1gtmc2

Details for d1gtmc1

PDB Entry: 1gtm (more details), 2.2 Å

PDB Description: structure of glutamate dehydrogenase

SCOP Domain Sequences for d1gtmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtmc1 c.2.1.7 (C:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus}
ggslgrieatargasytireaakvlgwdtlkgktiaiqgygnagyylakimsedfgmkvv
avsdskggiynpdglnadevlkwknehgsvkdfpgatnitneellelevdvlapaaieev
itkknadnikakivaevangpvtpeadeilfekgilqipdflcnaggvtvsyfewvqnit
gyywtieevrerldkkmtkafydvyniakeknihmrdaayvvavqrvyqamldrgwvkh

SCOP Domain Coordinates for d1gtmc1:

Click to download the PDB-style file with coordinates for d1gtmc1.
(The format of our PDB-style files is described here.)

Timeline for d1gtmc1: