SCOPe 2.06: Domain d1b2nd_: 1b2n D:

Lineage for d1b2nd_ (1b2n D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family)
   consists of single alpha-helix and irregular N-terminal tail
   automatically mapped to Pfam PF02315

5. Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)

6. Protein Methanol dehydrogenase, light chain [48668] (3 species)

7. Species Methylophilus methylotrophus, w3a1 [TaxId:17] [48669] (6 PDB entries)

8. Domain d1b2nd_: 1b2n D: [302214]
   Other proteins in same PDB: d1b2na_, d1b2nc_
   automated match to d1g72b_
   complexed with ca, moh, pqq

Details for d1b2nd_

PDB Entry: 1b2n, 1.9 Å

PDB Description: methanol dehydrogenase from methylophilus w3a1

PDB Compounds: (D:) protein (methanol dehydrogenase light subunit)

SCOPe Domain Sequences for d1b2nd_:

Sequence; same for both SEQRES and ATOM records:

>d1b2nd_ a.137.2.1 (D:) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrian

Timeline for d1b2nd_:

• d1b2nd_ is new in SCOPe 2.06-stable
  
• d1b2nd_ appears in SCOPe 2.07
  
• d1b2nd_ appears in the current release, SCOPe 2.08