SCOPe 2.07: Domain d1a9db1: 1a9d B:1-99

Lineage for d1a9db1 (1a9d B:1-99)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
   Uniprot P01887

8. Domain d1a9db1: 1a9d B:1-99 [302193]
   Other proteins in same PDB: d1a9da1, d1a9da2, d1a9db2
   automated match to d1rjyb_

Details for d1a9db1

PDB Entry: 1a9d, 2.6 Å

PDB Description: crystal structure of murine class i mhc h2-db complexed with a synthetic peptide p1027

PDB Compounds: (B:) class I MHC

SCOPe Domain Sequences for d1a9db1:

Sequence; same for both SEQRES and ATOM records:

>d1a9db1 b.1.1.2 (B:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1a9db1:

• d1a9db1 first appeared in SCOPe 2.06
  
• d1a9db1 appears in the current release, SCOPe 2.08