Lineage for d1bgva1 (1bgv A:195-449)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20664Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins)
  6. 20665Protein Glutamate dehydrogenase [51884] (5 species)
  7. 20666Species Clostridium symbiosum [TaxId:1512] [51885] (4 PDB entries)
  8. 20667Domain d1bgva1: 1bgv A:195-449 [30217]
    Other proteins in same PDB: d1bgva2

Details for d1bgva1

PDB Entry: 1bgv (more details), 1.9 Å

PDB Description: glutamate dehydrogenase

SCOP Domain Sequences for d1bgva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum}
karsfggslvrpeatgygsvyyveavmkhendtlvgktvalagfgnvawgaakklaelga
kavtlsgpdgyiydpegitteekinymlemrasgrnkvqdyadkfgvqffpgekpwgqkv
diimpcatqndvdleqakkivannvkyyievanmpttnealrflmqqpnmvvapskavna
ggvlvsgfemsqnserlswtaeevdsklhqvmtdihdgsaaaaeryglgynlvaganivg
fqkiadammaqgiaw

SCOP Domain Coordinates for d1bgva1:

Click to download the PDB-style file with coordinates for d1bgva1.
(The format of our PDB-style files is described here.)

Timeline for d1bgva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bgva2