Lineage for d1a5za1 (1a5z A:22-163)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 687902Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
  6. 687941Protein Lactate dehydrogenase [51859] (14 species)
  7. 688023Species Thermotoga maritima [TaxId:2336] [51867] (1 PDB entry)
  8. 688024Domain d1a5za1: 1a5z A:22-163 [30181]
    Other proteins in same PDB: d1a5za2
    complexed with cd, fbp, nad, oxm

Details for d1a5za1

PDB Entry: 1a5z (more details), 2.1 Å

PDB Description: lactate dehydrogenase from thermotoga maritima (tmldh)
PDB Compounds: (A:) l-lactate dehydrogenase

SCOP Domain Sequences for d1a5za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]}
mkigivglgrvgsstafallmkgfaremvlidvdkkraegdaldlihgtpftrraniyag
dyadlkgsdvvivaagvpqkpgetrlqllgrnarvmkeiarnvskyapdsivivvtnpvd
vltyfflkesgmdprkvfgs

SCOP Domain Coordinates for d1a5za1:

Click to download the PDB-style file with coordinates for d1a5za1.
(The format of our PDB-style files is described here.)

Timeline for d1a5za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a5za2