SCOP 1.67: Domain d1ltht1: 1lth T:7-149

Lineage for d1ltht1 (1lth T:7-149)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (7 proteins)

6. Protein Lactate dehydrogenase [51859] (13 species)

7. Species Bifidobacterium longum, strain am101-2 [TaxId:216816] [51866] (2 PDB entries)

8. Domain d1ltht1: 1lth T:7-149 [30180]
   Other proteins in same PDB: d1lthr2, d1ltht2
   complexed with fbp, nad, oxm; mutant

Details for d1ltht1

PDB Entry: 1lth, 2.5 Å

PDB Description: t and r states in the crystals of bacterial l-lactate dehydrogenase reveal the mechanism for allosteric control

SCOP Domain Sequences for d1ltht1:

Sequence; same for both SEQRES and ATOM records:

>d1ltht1 c.2.1.5 (T:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2}
ptklavigagavgstlafaaaqrgiareivlediakerveaevldmqhgssfyptvsidg
sddpeicrdadmvvitagprqkpgqsrlelvgatvnilkaimpnlvkvapnaiymlitnp
vdiathvaqkltglpenqifgsg

Timeline for d1ltht1:

• d1ltht1 first appeared (with stable ids) in SCOP 1.55
  
• d1ltht1 appears in SCOP 1.65
  
• d1ltht1 appears in SCOP 1.69
  
• d1ltht1 appears in the current release, SCOPe 2.08