Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (7 proteins) |
Protein Lactate dehydrogenase [51859] (13 species) |
Species Bifidobacterium longum, strain am101-2 [TaxId:216816] [51866] (2 PDB entries) |
Domain d1ltht1: 1lth T:7-149 [30180] Other proteins in same PDB: d1lthr2, d1ltht2 complexed with fbp, nad, oxm; mutant |
PDB Entry: 1lth (more details), 2.5 Å
SCOP Domain Sequences for d1ltht1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ltht1 c.2.1.5 (T:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2} ptklavigagavgstlafaaaqrgiareivlediakerveaevldmqhgssfyptvsidg sddpeicrdadmvvitagprqkpgqsrlelvgatvnilkaimpnlvkvapnaiymlitnp vdiathvaqkltglpenqifgsg
Timeline for d1ltht1: