Lineage for d1lldb1 (1lld B:7-149)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20534Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (3 proteins)
  6. 20541Protein Lactate dehydrogenase [51859] (8 species)
  7. 20553Species Bifidobacterium longum, strain am101-2 [TaxId:216816] [51866] (2 PDB entries)
  8. 20555Domain d1lldb1: 1lld B:7-149 [30178]
    Other proteins in same PDB: d1llda2, d1lldb2

Details for d1lldb1

PDB Entry: 1lld (more details), 2 Å

PDB Description: molecular basis of allosteric activation of bacterial l-lactate dehydrogenase

SCOP Domain Sequences for d1lldb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lldb1 c.2.1.5 (B:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2}
ptklavigagavgstlafaaaqrgiareivlediakerveaevldmqhgssfyptvsidg
sddpeicrdadmvvitagprqkpgqsrlelvgatvnilkaimpnlvkvapnaiymlitnp
vdiathvaqkltglpenqifgsg

SCOP Domain Coordinates for d1lldb1:

Click to download the PDB-style file with coordinates for d1lldb1.
(The format of our PDB-style files is described here.)

Timeline for d1lldb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lldb2