Lineage for d1llda1 (1lld A:7-149)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118692Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)
  6. 118699Protein Lactate dehydrogenase [51859] (11 species)
  7. 118711Species Bifidobacterium longum, strain am101-2 [TaxId:216816] [51866] (2 PDB entries)
  8. 118712Domain d1llda1: 1lld A:7-149 [30177]
    Other proteins in same PDB: d1llda2, d1lldb2

Details for d1llda1

PDB Entry: 1lld (more details), 2 Å

PDB Description: molecular basis of allosteric activation of bacterial l-lactate dehydrogenase

SCOP Domain Sequences for d1llda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2}
ptklavigagavgstlafaaaqrgiareivlediakerveaevldmqhgssfyptvsidg
sddpeicrdadmvvitagprqkpgqsrlelvgatvnilkaimpnlvkvapnaiymlitnp
vdiathvaqkltglpenqifgsg

SCOP Domain Coordinates for d1llda1:

Click to download the PDB-style file with coordinates for d1llda1.
(The format of our PDB-style files is described here.)

Timeline for d1llda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1llda2