Lineage for d2ldb_1 (2ldb 15-162)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 388231Family c.2.1.5: LDH N-terminal domain-like [51848] (7 proteins)
  6. 388242Protein Lactate dehydrogenase [51859] (13 species)
  7. 388243Species Bacillus stearothermophilus [TaxId:1422] [51864] (3 PDB entries)
  8. 388253Domain d2ldb_1: 2ldb 15-162 [30175]
    Other proteins in same PDB: d2ldb_2
    complexed with fbp, nad, so4

Details for d2ldb_1

PDB Entry: 2ldb (more details), 3 Å

PDB Description: structure determination and refinement of bacillus stearothermophilus lactate dehydrogenase

SCOP Domain Sequences for d2ldb_1:

Sequence, based on SEQRES records: (download)

>d2ldb_1 c.2.1.5 (15-162) Lactate dehydrogenase {Bacillus stearothermophilus}
mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
vatnpvdiltyatwkfsglphervigsg

Sequence, based on observed residues (ATOM records): (download)

>d2ldb_1 c.2.1.5 (15-162) Lactate dehydrogenase {Bacillus stearothermophilus}
mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
pvdiwdyddcrdadlvvicagaldlvdkniaifrsivesvmasgfqglflvatnpvdilt
yatwkfsglphervigsg

SCOP Domain Coordinates for d2ldb_1:

Click to download the PDB-style file with coordinates for d2ldb_1.
(The format of our PDB-style files is described here.)

Timeline for d2ldb_1: