Lineage for d2ldb_1 (2ldb 15-162)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20534Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (3 proteins)
  6. 20541Protein Lactate dehydrogenase [51859] (8 species)
  7. 20542Species Bacillus stearothermophilus [TaxId:1422] [51864] (3 PDB entries)
  8. 20552Domain d2ldb_1: 2ldb 15-162 [30175]
    Other proteins in same PDB: d2ldb_2

Details for d2ldb_1

PDB Entry: 2ldb (more details), 3 Å

PDB Description: structure determination and refinement of bacillus stearothermophilus lactate dehydrogenase

SCOP Domain Sequences for d2ldb_1:

Sequence, based on SEQRES records: (download)

>d2ldb_1 c.2.1.5 (15-162) Lactate dehydrogenase {Bacillus stearothermophilus}
mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
vatnpvdiltyatwkfsglphervigsg

Sequence, based on observed residues (ATOM records): (download)

>d2ldb_1 c.2.1.5 (15-162) Lactate dehydrogenase {Bacillus stearothermophilus}
mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
pvdiwdyddcrdadlvvicagaldlvdkniaifrsivesvmasgfqglflvatnpvdilt
yatwkfsglphervigsg

SCOP Domain Coordinates for d2ldb_1:

Click to download the PDB-style file with coordinates for d2ldb_1.
(The format of our PDB-style files is described here.)

Timeline for d2ldb_1: