SCOP 1.57: Domain d1ldb_1: 1ldb 15-162

Lineage for d1ldb_1 (1ldb 15-162)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families)

5. Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)

6. Protein Lactate dehydrogenase [51859] (10 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [51864] (3 PDB entries)

8. Domain d1ldb_1: 1ldb 15-162 [30174]
   Other proteins in same PDB: d1ldb_2

Details for d1ldb_1

PDB Entry: 1ldb, 2.8 Å

PDB Description: structure determination and refinement of bacillus stearothermophilus lactate dehydrogenase

SCOP Domain Sequences for d1ldb_1:

Sequence, based on SEQRES records:

>d1ldb_1 c.2.1.5 (15-162) Lactate dehydrogenase {Bacillus stearothermophilus}
mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
vatnpvdiltyatwkfsglphervigsg

Sequence, based on observed residues (ATOM records):

>d1ldb_1 c.2.1.5 (15-162) Lactate dehydrogenase {Bacillus stearothermophilus}
mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
pvdiwdyddcrdadlvvicagandlvdkniaifrsivesvmasgfqglflvatnpvdilt
yatwkfsglphervigsg

Timeline for d1ldb_1:

• d1ldb_1 first appeared (with stable ids) in SCOP 1.55
  
• d1ldb_1 appears in SCOP 1.59
  
• d1ldb_1 appears in the current release, SCOPe 2.08, called d1ldba1