Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins) |
Protein Lactate dehydrogenase [51859] (14 species) |
Species Bacillus stearothermophilus [TaxId:1422] [51864] (3 PDB entries) |
Domain d1ldng1: 1ldn G:15-162 [30172] Other proteins in same PDB: d1ldna2, d1ldnb2, d1ldnc2, d1ldnd2, d1ldne2, d1ldnf2, d1ldng2, d1ldnh2 complexed with fbp, nad, oxm |
PDB Entry: 1ldn (more details), 2.5 Å
SCOPe Domain Sequences for d1ldng1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldng1 c.2.1.5 (G:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl vatnpvdiltyatwkfsglphervigsg
Timeline for d1ldng1: