SCOPe 2.01: Domain d1ldng1: 1ldn G:15-162

Lineage for d1ldng1 (1ldn G:15-162)

Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)
Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
Protein Lactate dehydrogenase [51859] (14 species)
Species Bacillus stearothermophilus [TaxId:1422] [51864] (3 PDB entries)
Domain d1ldng1: 1ldn G:15-162 [30172]
Other proteins in same PDB: d1ldna2, d1ldnb2, d1ldnc2, d1ldnd2, d1ldne2, d1ldnf2, d1ldng2, d1ldnh2
complexed with fbp, nad, oxm

Details for d1ldng1

PDB Entry: 1ldn (more details), 2.5 Å

PDB Description: structure of a ternary complex of an allosteric lactate dehydrogenase from bacillus stearothermophilus at 2.5 angstroms resolution

PDB Compounds: (G:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1ldng1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldng1 c.2.1.5 (G:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
vatnpvdiltyatwkfsglphervigsg

SCOPe Domain Coordinates for d1ldng1:

Click to download the PDB-style file with coordinates for d1ldng1.
(The format of our PDB-style files is described here.)

Timeline for d1ldng1: