Lineage for d8ldh_1 (8ldh 1-160)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20534Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (3 proteins)
  6. 20541Protein Lactate dehydrogenase [51859] (8 species)
  7. 20558Species Dogfish (Squalus acanthias) [TaxId:7797] [51862] (3 PDB entries)
  8. 20561Domain d8ldh_1: 8ldh 1-160 [30162]
    Other proteins in same PDB: d8ldh_2

Details for d8ldh_1

PDB Entry: 8ldh (more details), 2.8 Å

PDB Description: refined crystal structure of dogfish m4 apo-lactate dehydrogenase

SCOP Domain Sequences for d8ldh_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d8ldh_1 c.2.1.5 (1-160) Lactate dehydrogenase {Dogfish (Squalus acanthias)}
atlkdklighlatsqeprsynkitvvgvgavgmacaisilmkdladevalvdvmedklkg
emmdlqhgslflhtakivsgkdysvsagsklvvitagarqqegesrlnlvqrnvnifkfi
ipnivkhspdciilvvsnpvdvltyvawklsglpmhriig

SCOP Domain Coordinates for d8ldh_1:

Click to download the PDB-style file with coordinates for d8ldh_1.
(The format of our PDB-style files is described here.)

Timeline for d8ldh_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d8ldh_2