Lineage for d6ldh_1 (6ldh 1-160)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66781Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)
  6. 66788Protein Lactate dehydrogenase [51859] (10 species)
  7. 66805Species Dogfish (Squalus acanthias) [TaxId:7797] [51862] (3 PDB entries)
  8. 66807Domain d6ldh_1: 6ldh 1-160 [30161]
    Other proteins in same PDB: d6ldh_2

Details for d6ldh_1

PDB Entry: 6ldh (more details), 2 Å

PDB Description: refined crystal structure of dogfish m4 apo-lactate dehydrogenase

SCOP Domain Sequences for d6ldh_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ldh_1 c.2.1.5 (1-160) Lactate dehydrogenase {Dogfish (Squalus acanthias)}
atlkdklighlatsqeprsynkitvvgvgavgmacaisilmkdladevalvdvmedklkg
emmdlqhgslflhtakivsgkdysvsagsklvvitagarqqegesrlnlvqrnvnifkfi
ipnivkhspdciilvvsnpvdvltyvawklsglpmhriig

SCOP Domain Coordinates for d6ldh_1:

Click to download the PDB-style file with coordinates for d6ldh_1.
(The format of our PDB-style files is described here.)

Timeline for d6ldh_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ldh_2