SCOPe 2.04: Domain d1ldma1: 1ldm A:1-160

Lineage for d1ldma1 (1ldm A:1-160)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (18 species)

7. Species Dogfish (Squalus acanthias) [TaxId:7797] [51862] (3 PDB entries)

8. Domain d1ldma1: 1ldm A:1-160 [30160]
   Other proteins in same PDB: d1ldma2
   complexed with nad, oxm

Details for d1ldma1

PDB Entry: 1ldm, 2.1 Å

PDB Description: refined crystal structure of dogfish m4 apo-lactate dehydrogenase

PDB Compounds: (A:) m4 lactate dehydrogenase

SCOPe Domain Sequences for d1ldma1:

Sequence; same for both SEQRES and ATOM records:

>d1ldma1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Dogfish (Squalus acanthias) [TaxId: 7797]}
atlkdklighlatsqeprsynkitvvgvgavgmacaisilmkdladevalvdvmedklkg
emmdlqhgslflhtakivsgkdysvsagsklvvitagarqqegesrlnlvqrnvnifkfi
ipnivkhspdciilvvsnpvdvltyvawklsglpmhriig

Timeline for d1ldma1:

• d1ldma1 first appeared (with stable ids) in SCOP 1.55, called d1ldm_1
  
• d1ldma1 appears in SCOPe 2.03
  
• d1ldma1 appears in SCOPe 2.05
  
• d1ldma1 appears in the current release, SCOPe 2.08