Lineage for d5ldha1 (5ldh A:1-162)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1829377Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1829416Protein Lactate dehydrogenase [51859] (17 species)
  7. 1829589Species Pig (Sus scrofa) [TaxId:9823] [51860] (3 PDB entries)
  8. 1829594Domain d5ldha1: 5ldh A:1-162 [30158]
    Other proteins in same PDB: d5ldha2, d5ldhb2
    complexed with cit, lnc

Details for d5ldha1

PDB Entry: 5ldh (more details), 2.7 Å

PDB Description: structure of the active ternary complex of pig heart lactate dehydrogenase with s-lac-nad at 2.7 angstroms resolution
PDB Compounds: (A:) lactate dehydrogenase

SCOPe Domain Sequences for d5ldha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ldha1 c.2.1.5 (A:1-162) Lactate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
atlkekliapvaqqettipdnkitvvgvgqvgmacaisilgksltdelalvdvledklkg
emmdlqhgslflqtpkivankdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
ipqivkyspnciiivvsnpvdiltyvawklsglpkhrvig

SCOPe Domain Coordinates for d5ldha1:

Click to download the PDB-style file with coordinates for d5ldha1.
(The format of our PDB-style files is described here.)

Timeline for d5ldha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ldha2