Lineage for d9ldbb1 (9ldb B:1-162)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20534Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (3 proteins)
  6. 20541Protein Lactate dehydrogenase [51859] (8 species)
  7. 20570Species Pig (Sus scrofa) [TaxId:9823] [51860] (3 PDB entries)
  8. 20574Domain d9ldbb1: 9ldb B:1-162 [30157]
    Other proteins in same PDB: d9ldba2, d9ldbb2

Details for d9ldbb1

PDB Entry: 9ldb (more details), 2.2 Å

PDB Description: design and synthesis of new enzymes based on the lactate dehydrogenase framework

SCOP Domain Sequences for d9ldbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d9ldbb1 c.2.1.5 (B:1-162) Lactate dehydrogenase {Pig (Sus scrofa)}
atlkdqlihnllkeehvphnkitvvgvgavgmacaisilmkeladeialvdvmedklkge
mmdlqhgslflrtpkivsgkdynvtansrlvvitagarqqegesrlnlvqrnvnifkfii
pnivkyspnckllvvsnpvdiltyvawkisgfpknrvig

SCOP Domain Coordinates for d9ldbb1:

Click to download the PDB-style file with coordinates for d9ldbb1.
(The format of our PDB-style files is described here.)

Timeline for d9ldbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d9ldbb2