SCOPe 2.06: Domain d1hyhd1: 1hyh D:21-166

Lineage for d1hyhd1 (1hyh D:21-166)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein L-2-hydroxyisocapronate dehydrogenase, L-HICDH [51857] (1 species)

7. Species Lactobacillus confusus [TaxId:1583] [51858] (1 PDB entry)

8. Domain d1hyhd1: 1hyh D:21-166 [30153]
   Other proteins in same PDB: d1hyha2, d1hyhb2, d1hyhc2, d1hyhd2
   complexed with nad, so4

Details for d1hyhd1

PDB Entry: 1hyh, 2.2 Å

PDB Description: crystal structure of l-2-hydroxyisocaproate dehydrogenase from lactobacillus confusus at 2.2 angstroms resolution-an example of strong asymmetry between subunits

PDB Compounds: (D:) l-2-hydroxyisocaproate dehydrogenase

SCOPe Domain Sequences for d1hyhd1:

Sequence, based on SEQRES records:

>d1hyhd1 c.2.1.5 (D:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]}
arkigiiglgnvgaavahgliaqgvaddyvfidaneakvkadqidfqdamanleahgniv
indwaaladadvvistlgniklqqdnptgdrfaelkftssmvqsvgtnlkesgfhgvlvv
isnpvdvitalfqhvtgfpahkvigt

Sequence, based on observed residues (ATOM records):

>d1hyhd1 c.2.1.5 (D:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]}
arkigiiglgnvgaavahgliaqgvaddyvfidaneakvkadqidfqdamanleahgniv
indwaaladadvvistlggdrfaelkftssmvqsvgtnlkesgfhgvlvvisnpvdvita
lfqhvtgfpahkvigt

Timeline for d1hyhd1:

• d1hyhd1 first appeared (with stable ids) in SCOP 1.55
  
• d1hyhd1 appears in SCOPe 2.05
  
• d1hyhd1 appears in SCOPe 2.07
  
• d1hyhd1 appears in the current release, SCOPe 2.08