Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (7 proteins) |
Protein Malate dehydrogenase [51849] (11 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [51855] (5 PDB entries) |
Domain d1hlpa1: 1hlp A:21-162 [30145] Other proteins in same PDB: d1hlpa2, d1hlpb2 |
PDB Entry: 1hlp (more details), 3.2 Å
SCOP Domain Sequences for d1hlpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hlpa1 c.2.1.5 (A:21-162) Malate dehydrogenase {Archaeon Haloarcula marismortui} tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn pvdllnrhlyeagdrsreqvigfg
Timeline for d1hlpa1: